PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_28556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family NAC
Protein Properties Length: 326aa    MW: 36711.6 Da    PI: 8.6854
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_28556genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.85e-5471321128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhP+deelv++yL++k+++ ++ + ++i +vd++k+ePwdLp k++ +ek wyfFs +d+ky+tg r+nrat++gyWk+tgkdke+++  g+l
  PEQU_28556   7 LPPGFRFHPSDEELVTYYLTHKIADFSFVT-KAIVDVDLNKCEPWDLPGKASMGEKVWYFFSLKDRKYPTGMRTNRATHAGYWKTTGKDKEIFH-YGAL 103
                 79*************************998.88***************9889999***************************************.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrl 128
                 vg+kktLvfykgrapkgekt+Wvmheyr 
  PEQU_28556 104 VGMKKTLVFYKGRAPKGEKTSWVMHEYRQ 132
                 ***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-624153IPR003441NAC domain
PROSITE profilePS5100557.6587153IPR003441NAC domain
PfamPF023652.6E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDMEEGLPPG FRFHPSDEEL VTYYLTHKIA DFSFVTKAIV DVDLNKCEPW DLPGKASMGE  60
KVWYFFSLKD RKYPTGMRTN RATHAGYWKT TGKDKEIFHY GALVGMKKTL VFYKGRAPKG  120
EKTSWVMHEY RQQTKFPYKP SKEEWVVCRV FKKSNNFNMK KNQPSSPPVP MLLQSPGNTT  180
SLSELGEIDV SILNNLTNST GPFNPLLVNA NDGSLNANGN ASNNNDGNKI DLNLYMNWLY  240
GRSETAGQPF LPWPTSLLSS NSGPNPAILK ALQLSSYQLP MEILNMGCSM NSFAGQGDQV  300
FFGNHEPKHG DAIPQQQVEQ SLWKGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-52715617168NO APICAL MERISTEM PROTEIN
1ut4_B4e-52715617168NO APICAL MERISTEM PROTEIN
1ut7_A4e-52715617168NO APICAL MERISTEM PROTEIN
1ut7_B4e-52715617168NO APICAL MERISTEM PROTEIN
3swm_A4e-52715620171NAC domain-containing protein 19
3swm_B4e-52715620171NAC domain-containing protein 19
3swm_C4e-52715620171NAC domain-containing protein 19
3swm_D4e-52715620171NAC domain-containing protein 19
3swp_A4e-52715620171NAC domain-containing protein 19
3swp_B4e-52715620171NAC domain-containing protein 19
3swp_C4e-52715620171NAC domain-containing protein 19
3swp_D4e-52715620171NAC domain-containing protein 19
4dul_A4e-52715617168NAC domain-containing protein 19
4dul_B4e-52715617168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010916375.11e-139PREDICTED: NAC domain-containing protein 100
TrEMBLB9IE381e-111B9IE38_POPTR; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-88NAC domain containing protein 58